PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30063.m001397
Common NameRCOM_1296350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family CAMTA
Protein Properties Length: 1019aa    MW: 114055 Da    PI: 6.3905
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30063.m001397genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-171.61.1e-228503577
           CG-1 35 ksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77
                     gsl+L++rk++ryfrkDG++w+kkkdgktvrE+hekLKv  
  30063.m001397  8 AGGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVREAHEKLKVVC 50
                   579*************************************964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143727.1691111IPR005559CG-1 DNA-binding domain
SMARTSM010768.2E-7275IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-16949IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.1E-6414519IPR013783Immunoglobulin-like fold
PfamPF018335.4E-6433511IPR002909IPT domain
SuperFamilySSF812964.2E-17433518IPR014756Immunoglobulin E-set
PfamPF127962.6E-6614693IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029718.935616727IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.64E-17617727IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.0E-17622728IPR020683Ankyrin repeat-containing domain
CDDcd002041.46E-12622725No hitNo description
SMARTSM002486.1E-4666695IPR002110Ankyrin repeat
PROSITE profilePS5008811.087666698IPR002110Ankyrin repeat
SuperFamilySSF525401.54E-7841892IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.48841863IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.821843871IPR000048IQ motif, EF-hand binding site
PfamPF006120.0015844862IPR000048IQ motif, EF-hand binding site
SMARTSM000150.023864886IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.395865889IPR000048IQ motif, EF-hand binding site
PfamPF006124.5E-4867886IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1019 aa     Download sequence    Send to blast
MALTHFLAGG SLFLFDRKVL RYFRKDGHNW RKKKDGKTVR EAHEKLKVVC LYNSEMQHSS  60
SNYRLEVLMY YTVIMPMVKR MRAFKGAVIG CLNSRRIAGL VVPDLTTSNS EIFLDILEGK  120
ERNGLQIVLL KFPLGNATES RLAYSWTNNS PSNSLIASSN KEPSGNTDST SPTSTLTSFC  180
EDADSADSQQ VNSGHHSYLE SPLMQSSPVI GKMNAGALSS HFLHPGSGPI SYVHGDRPGN  240
NGSSITEAQS LKSWEEVLEQ CTRGDKNAPS HLSTTSTQSD ATGIGRSMTL KLAYDLDTRL  300
LDQRTHNVDF PTTLEEFFSG PIHQNEELVH NNHHMLLTHA DQQLLMHTKS ENDMSVEENG  360
KYAFILKQPL LDGEEGLKKV DSFSRWVTRE LGEVDDLHMK SSSGIPWSTV ECGTVVDESS  420
LSPSLSQDQL FSIIDFSPKW GYADSKTEVH ISGTFLKSQH EVTKYNWSCM FGELEVPAEV  480
LADGILCCYA PPHSVASVPF YVTCSNRLAC SEVREFDYQS GSAEDVDVLD VYGGDAHDMY  540
LHLRLERLLS LRSSSPSCLF DGAREKHNLV EKLILLKEED EGCQVAETTS ERQLSQDEIR  600
NKFLQKGMQE KLYSWLLHTV AECGKGPSML DDDGQGMLHL AAALGYDWAI KPTMTAGVSI  660
NFRDVNGWTA LHWAAFYGRE QTVAALVSLG ADTRVLTDPS PEFPLGSTPA DLASGNGHKG  720
ISGFLAESSL TSYLHLLTLN DSVEGGAPEG SGMTAVQTIS ERMATPVKDG DVPNVLSLKD  780
SLTAIRNATQ AANRIYQVFR MQSFQRKQLT EYSDDEIGML DERALALIAA KTPKPLHSDG  840
VVNAAAIQIQ KKYRGWKKRK EFLIIRQRIV KIQAHIRGHQ VRKQYRTIIW SVGILEKVIL  900
RWRRKGSGLR GFRREALPIP KESNVQCENP KEDDYDFLKE GRKQNEVRQQ KALTRVKSMY  960
HCSEGQAQYR RLLNYFEKFR ETKENEMILS SPNEMAYGEN LIDIDSLLDD DTFMSIAFE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0073045e-32AP007304.2 Lotus japonicus genomic DNA, chromosome 4, clone: LjB10F10, BM1099, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574793.10.0PREDICTED: calmodulin-binding transcription activator 2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLB9S0360.0B9S036_RICCO; Calmodulin-binding transcription activator (Camta), plants, putative
STRINGGLYMA05G24430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74062642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains